PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00021671-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family MYB_related
Protein Properties Length: 1143aa    MW: 129591 Da    PI: 6.6192
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00021671-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding23.41.4e-079741014446
                        S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding    4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46  
                        WT  E  l+++a  ++G++ + +I++++   Rt+ qc+ ++ k
  PSME_00021671-RA  974 WTDNEKCLFINALGKYGKD-FQSISSHVH-SRTEDQCRTFFCK 1014
                        *****************99.*********.********99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.95E-13736798IPR009057Homeodomain-like
PROSITE profilePS5129315.032748799IPR017884SANT domain
SMARTSM007174.7E-5749797IPR001005SANT/Myb domain
PROSITE profilePS5129315.7189691020IPR017884SANT domain
SMARTSM007171.3E-69701018IPR001005SANT/Myb domain
SuperFamilySSF466893.29E-109701019IPR009057Homeodomain-like
PfamPF002499.5E-79731014IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.9E-69731014IPR009057Homeodomain-like
CDDcd001672.39E-59741014No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1143 aa     Download sequence    Send to blast
MQFPSYKKRR FPEDDNTSLR FEGRHTIGKE TTGFFIDSRY QRNARKLHHW KSEENCMFSP  60
DKHHILRGKS VEMPFHFTRL CDAEDSWQQE QSKKLSTRDL ELYSKTDREF SSRKYYKFGT  120
NKRGFDDHFG RFTEKDLGAR HDMYSALGKN ADIVDGFRSI PRGSQLTSFL PNMPASSRSA  180
NLRSWSSVSD YVEHSNELRR DRELGEFGTK PRHKFYLKST SSICHGTNDK FRQQKRPRLG  240
WGEGLAKYEN QSVDGDYIDK NGFIQSKNCA SQEDGYSQGP NDESESPEPI LASTQCKPSK  300
PLDSLTSISL PDEHAYAFGD GSSKSADCEK LCNDIPSTCK HGEFSLLAEG TLPVCISQIP  360
DAEDPLDAQY LDSNSFAPVN SKTSDTFEIQ YPSERQLELK NEILQKLERV ECEFDRVEKE  420
LGCLNSEIQT EDCHSGGVDI SVYCSQGAFT EVDEKRSLKD LSGSIKVSSS GYINKNRIIV  480
PSLASKSDEV GVRNQCFIEL PFEYQRRVTE DSKPVMWAVG RQSTVGINSM DANLEDEAVE  540
SQLAVAEDSS SYSSIKANSR ATSQLNSNVG SSVLFNSTPL PASSASGAWL LSSEVSQMSV  600
WKQNTVVHER NRKQMEEKIV ERKRFLNFKE QMLALKFRIL REWREKEQLV LSPRKGRGKY  660
HQIDGFFSSV HLPSYQFQSS LQGALTLVPT SQQGLLERRR ALDVHLNNYR AFLKMPAMTL  720
DDRWRRFPRI LTNNGLVEDP VAVEKERKVI NPWTSEEKAL FWAKFAIFRK NFGKVASFLE  780
HKTVADCIEF YYKNHKSEDP KKSKKRQSLR KQESNFFARP YLSTLGNRRC HISYATSLDV  840
LGAAVALTMD DTNQKNRIQG ALQMCNGTQM PLVSKKIRSE VCGKHDNDRT TDTYFLGSET  900
EFTAAADVLA GTYPEAIGSC ICSAADIPET FDKKPHDKRF MIKADGIDLP QTSEADFENC  960
NSTAECHEDI YTDWTDNEKC LFINALGKYG KDFQSISSHV HSRTEDQCRT FFCKSRKALK  1020
LDEVVSQEPV IQRKSAADLN PGLSEMYVDD MSLSNVPASD KTTETFKSHV IDAARQSSRT  1080
EIGLDEAAQV YHPHNIIESE DCKVAQDEEI ELEEQWKICK RNLAGVSMEA SAHQEAKSML  1140
GGA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_C9e-17710801494NUCLEAR RECEPTOR COREPRESSOR 2
4a69_D9e-17710801494NUCLEAR RECEPTOR COREPRESSOR 2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1053791e-179BT105379.1 Picea glauca clone GQ02821_K16 mRNA sequence.
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.13e-56MYB family protein